Transcript | Ll_transcript_356498 |
---|---|
CDS coordinates | 673-1080 (+) |
Peptide sequence | MGNCTAKPLANDNDSDHDVEFVSGNVQLITTKEAWDQKLEQARHDGKIVIANFTAKWCGPCKTIAPYYCELSEKHPSILFLLVDVDELADFSTSWDIKATPTFFFLRDGEEIDKLVGANKPELEKKIGAVTKSPT* |
ORF Type | complete |
Blastp | Thioredoxin H-type from Populus with 66.92% of identity |
---|---|
Blastx | Thioredoxin H-type from Populus with 66.92% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464161.1) |
Pfam | Thioredoxin (PF00085.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer