Protein coding transcript 17420

• Transcript: Ll_transcript_356501
• CDS coordinates: 1499-1906 (+)
• Peptide sequence: MGNCTAKPLANDNDSDHDVEFVSGNVQLITTKEAWDQKLEQARHDGKIVIANFTAKWCGPCKTIAPYYCELSEKHPSILFLLVDVDELADFSTSWDIKATPTFFFLRDGEEIDKLVGANKPELEKKIGAVTKSPT*
• ORF Type: complete

Annotations of Ll_transcript_356501

• Blastp: Thioredoxin H-type from Populus with 66.92% of identity
• Blastx: Thioredoxin H-type from Populus with 66.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464161.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;