Protein coding transcript 17423

• Transcript: Ll_transcript_356516
• CDS coordinates: 3-389 (+)
• Peptide sequence: PLANDNDSDHDVEFVSGNVQLITTKESWDQKLEQARHDGKIVIANFTAKWCGPCKTIAPYYCELSEKHPSILFLLVDVDELADFSTSWDIKATPTFFFLRDGEEIDKLVGANKPELEKKIGAVTKSPT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_356516

• Blastp: Thioredoxin H9 from Arabidopsis with 69.92% of identity
• Blastx: Thioredoxin H9 from Arabidopsis with 69.92% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT3G08710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464161.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;