Transcript | Ll_transcript_91625 |
---|---|
CDS coordinates | 1823-2215 (+) |
Peptide sequence | MRKHADSSTAWSFDVSYVNMAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCMWGYSLTIFIISSFLLMIPFEFLRWTIIIATGASSASFVALNLRSYIEGNDLSVAIVAAFLLQIALAVFIKVWFFV* |
ORF Type | complete |
Blastp | Protein YIPF1 homolog from Dictyostelium with 28.24% of identity |
---|---|
Blastx | Protein YIPF1 homolog from Dictyostelium with 31.75% of identity |
Eggnog | Yip1 domain family(ENOG4110TJR) |
Kegg | Link to kegg annotations (DDB_G0281587) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460613.1) |
Pfam | - |
Rfam | tRNA (RF00005) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer