Protein coding transcript 174296

• Transcript: Ll_transcript_91625
• CDS coordinates: 1823-2215 (+)
• Peptide sequence: MRKHADSSTAWSFDVSYVNMAACSIYGYAIVVPLAYYFFLQYMGSNASLIRFWCMWGYSLTIFIISSFLLMIPFEFLRWTIIIATGASSASFVALNLRSYIEGNDLSVAIVAAFLLQIALAVFIKVWFFV*
• ORF Type: complete

Annotations of Ll_transcript_91625

• Blastp: Protein YIPF1 homolog from Dictyostelium with 28.24% of identity
• Blastx: Protein YIPF1 homolog from Dictyostelium with 31.75% of identity
• Eggnog: Yip1 domain family(ENOG4110TJR)
• Kegg: Link to kegg annotations (DDB_G0281587)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460613.1)
• Pfam: -
• Rfam: tRNA (RF00005)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;