Transcript | Ll_transcript_91636 |
---|---|
CDS coordinates | 237-566 (+) |
Peptide sequence | MSTFLFLLEDHADVFKFQLFRDKSREKQRKKNLQAKKEAKEKEVKPQKPSKTPNNSAVMRKKTAKQRRAQQTAEDEEELTQEYRLLKKLKKGIIDENEYAKLTGTEELL* |
ORF Type | complete |
Blastp | DEAD-box ATP-dependent RNA helicase 18 from Oryza sativa with 50.51% of identity |
---|---|
Blastx | DEAD-box ATP-dependent RNA helicase 18 from Oryza sativa with 68.89% of identity |
Eggnog | atp-dependent rna helicase(ENOG410XNT7) |
Kegg | Link to kegg annotations (4324413) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437571.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer