Protein coding transcript 174306

• Transcript: Ll_transcript_91636
• CDS coordinates: 237-566 (+)
• Peptide sequence: MSTFLFLLEDHADVFKFQLFRDKSREKQRKKNLQAKKEAKEKEVKPQKPSKTPNNSAVMRKKTAKQRRAQQTAEDEEELTQEYRLLKKLKKGIIDENEYAKLTGTEELL*
• ORF Type: complete

Annotations of Ll_transcript_91636

• Blastp: DEAD-box ATP-dependent RNA helicase 18 from Oryza sativa with 50.51% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 18 from Oryza sativa with 68.89% of identity
• Eggnog: atp-dependent rna helicase(ENOG410XNT7)
• Kegg: Link to kegg annotations (4324413)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437571.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;