Transcript | Ll_transcript_88772 |
---|---|
CDS coordinates | 350-952 (+) |
Peptide sequence | MYLQSSWNFKFNPIWLQQPVGNLYCMNHIERNFGLSEENISKWRSFMSEESNILIAETETPEGTTNSISESPTSHSSSYTKPVTCKNTEVNFLCRDRTVTPAGIGDEMRKKKVITRTTRVVYPFAMVKPGGTEGDLTLNDINERIMMPPTRAVRHPVGDFACQPCVSVQGPGLSGKAVMTLTRIHTLGRRGTITIIRTKG* |
ORF Type | complete |
Blastp | Protein XRI1 from Arabidopsis with 42.17% of identity |
---|---|
Blastx | Protein XRI1 from Arabidopsis with 42.17% of identity |
Eggnog | NA(ENOG410YGP1) |
Kegg | Link to kegg annotations (AT5G48720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462744.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer