Protein coding transcript 174360

• Transcript: Ll_transcript_88773
• CDS coordinates: 180-932 (+)
• Peptide sequence: MDGSAISFSPQEYSDFSTGYLDDALIQFTSKRRCLMPCTDGQQSKSNSIDDFEKSSWNFKFNPIWLQQPVGNLYCMNHIERNFGLSEENISKWRSFMSEESNILIAETETPEGTTNSISESPTSHSSSYTKPVTCKNTEVNFLCRDRTVTPAGIGDEMRKKKVITRTTRVVYPFAMVKPGGTEGDLTLNDINERIMMPPTRAVRHPVGDFACQPCVSVQGPGLSGKAVMTLTRIHTLGRRGTITIIRTKG*
• ORF Type: complete

Annotations of Ll_transcript_88773

• Blastp: Protein XRI1 from Arabidopsis with 43.21% of identity
• Blastx: Protein XRI1 from Arabidopsis with 42.17% of identity
• Eggnog: NA(ENOG410YGP1)
• Kegg: Link to kegg annotations (AT5G48720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462744.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;