Protein coding transcript 174383

• Transcript: Ll_transcript_91583
• CDS coordinates: 301-1110 (+)
• Peptide sequence: MNNNMNNFMPFPGARRTGFRAYDPQSFNHSDANEVPVFYRSRSIMAFDERNSSVIDPWRLWEDRTPTGFHSIPIFPGQPHSRQQTYVPHNGNMERVFNPRLREIFQHSPPRFTFQTSTQVVPPVIENSKSTVLSKLKKEVYNPTPKLLARNLSSYYRDKYNRVNGLTERRKEKDEDGKRCAICLEDFEPKEEVMTTPCKHMFHEDCIVPWLISHSQCPVCRFVISERVRGNPSSFNNNDNTNLEPSDQIDGELLSILRAMEEAFHFTSH*
• ORF Type: complete

Annotations of Ll_transcript_91583

• Blastp: E3 ubiquitin-protein ligase RING1 from Gossypium with 42.25% of identity
• Blastx: Protein goliath from Sophophora with 41.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449976.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;