Protein coding transcript 174384

• Transcript: Ll_transcript_91585
• CDS coordinates: 685-1218 (+)
• Peptide sequence: MERVFNPRLREIFQHSPPRFTFQTSTQVVPPVIENSKSTVLSKLKKEVYNPTPKLLARNLSSYYRDKYNRVNGLTERRKEKDEDGKRCAICLEDFEPKEEVMTTPCKHMFHEDCIVPWLISHSQCPVCRFVISERVRGNPSSFNNNDNTNLEPSDQIDGELLSILRAMEEAFHFTSH*
• ORF Type: complete

Annotations of Ll_transcript_91585

• Blastp: E3 ubiquitin-protein ligase RING1 from Gossypium with 41.67% of identity
• Blastx: E3 ubiquitin-protein ligase RING1-like from Arabidopsis with 31.3% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449977.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;