Protein coding transcript 174395

• Transcript: Ll_transcript_88828
• CDS coordinates: 92-943 (+)
• Peptide sequence: MSQEQPQRPEEKEAVKYGDVFGVKGDLATNKVAPKDAAMMQRAENAKLGMTQKGGAAAAMQSAAVKNEKSGVVGHNDTSKVAGEGGVKVAETDGPGNRVISETIAGQVVHKLQEKERKICKLAEVVEQFSQKVSLGIMTPPSLVEEMGIGGGGSSGITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARVTKYEEKTKLGDILADATSKLPSDRPATRRDAEGVVGAELRNDPYLTTHPGGVSASVAAAARLNQTKHN*
• ORF Type: complete

Annotations of Ll_transcript_88828

• Blastp: Late embryogenesis abundant protein 31 from Arabidopsis with 55% of identity
• Blastx: Late embryogenesis abundant protein D-34 from Gossypium with 53.85% of identity
• Eggnog: late embryogenesis abundant protein(ENOG4111RXD)
• Kegg: Link to kegg annotations (AT3G22490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427454.1)
• Pfam: Seed maturation protein (PF04927.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;