Transcript | Ll_transcript_88830 |
---|---|
CDS coordinates | 2-493 (-) |
Peptide sequence | FSPLFRVQQETIMSQEQPHRPEEKEAIKYGDVFGVKGDIASNVVAPKDAAMMQKAENNMIGKTKKGGAAAAMQSAAMKNEKSGAVGHNDVSKIAGDGGVNLSESNDDTGNSVISESVAGQVVHKVEEKEKEKERKICKLAEVVEQFSRKVPLSTMAPSSIVEEV |
ORF Type | internal |
Blastp | Late embryogenesis abundant protein D-34 from Gossypium with 55.56% of identity |
---|---|
Blastx | Late embryogenesis abundant protein D-34 from Gossypium with 54.78% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452233.1) |
Pfam | Seed maturation protein (PF04927.11) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer