Transcript | Ll_transcript_88837 |
---|---|
CDS coordinates | 128-694 (+) |
Peptide sequence | MTTEAAVEEVVAVASPEPEIGSKNKLERQWTFWLDNQSKTKQGAAWGSSLRKIYTFDTVQEFWCLYDQIFKPGKLVGNVDFHLFKTGVEPKWEDPECANGGKWTVVSNRKSNLDTMWLETLMALIGEQFDDAEDICGVVASVRQRQDKLSLWTKTAANEAAQMSIGRKWKEIIDVTDKITYSFHVNFC* |
ORF Type | complete |
Blastp | Eukaryotic translation initiation factor isoform 4E-2 from Triticum with 70.31% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor isoform 4E-2 from Triticum with 78.88% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429513.1) |
Pfam | Eukaryotic initiation factor 4E (PF01652.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer