Protein coding transcript 174402

• Transcript: Ll_transcript_88851
• CDS coordinates: 128-634 (+)
• Peptide sequence: MTTEAAVEEVVAVASPEPEIGSKNKLERQWTFWLDNQSKTKQGAAWGSSLRKIYTFDTVQEFWCLYDQIFKPGKLVGNVDFHLFKTGVEPKWEDPECANGGKWTVVSNRKSNLDTMWLETLMALIGEQFDDAEDICGVVASVRQRQDKLSLWTKTAANEAAQAFKIDV*
• ORF Type: complete

Annotations of Ll_transcript_88851

• Blastp: Eukaryotic translation initiation factor isoform 4E-2 from Triticum with 71.18% of identity
• Blastx: Eukaryotic translation initiation factor isoform 4E-2 from Triticum with 80.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429513.1)
• Pfam: Eukaryotic initiation factor 4E (PF01652.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;