Transcript | Ll_transcript_90296 |
---|---|
CDS coordinates | 201-623 (+) |
Peptide sequence | MADNTQGSSFLEGYKQFWSQRFSFLSNYSRFVKRDQPIRSWSSSDVEEFIASDPVHGPVLRTAREAVQFGLAGSALGALYTAGFAWKYSKSLHGAALSFAAGGVFGWTFGHEVANHALQLYRVDTLAAEVKFLEWWKTKN* |
ORF Type | complete |
Blastp | Succinate dehydrogenase subunit 6, mitochondrial from Arabidopsis with 73.44% of identity |
---|---|
Blastx | Succinate dehydrogenase subunit 6, mitochondrial from Arabidopsis with 73.44% of identity |
Eggnog | Rickettsia 17 kDa surface antigen family protein(ENOG410XWZS) |
Kegg | Link to kegg annotations (AT1G08480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445851.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer