Protein coding transcript 174426

• Transcript: Ll_transcript_90307
• CDS coordinates: 213-635 (+)
• Peptide sequence: MADNTQGSSFLEGYKQFWSQRFSFLSNYSRFVKRDQPIRSWSSSDVEEFIASDPVHGPVLRTAREAVQFGLAGSALGALYTAGFAWKYSKSLHGAALSFAAGGVFGWTFGHEVANHALQLYRVDTLAAEVKFLEWWKTKN*
• ORF Type: complete

Annotations of Ll_transcript_90307

• Blastp: Succinate dehydrogenase subunit 6, mitochondrial from Arabidopsis with 73.44% of identity
• Blastx: Succinate dehydrogenase subunit 6, mitochondrial from Arabidopsis with 73.44% of identity
• Eggnog: Rickettsia 17 kDa surface antigen family protein(ENOG410XWZS)
• Kegg: Link to kegg annotations (AT1G08480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445851.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;