Transcript | Ll_transcript_89055 |
---|---|
CDS coordinates | 142-750 (+) |
Peptide sequence | MNNLYYLNLKATIPLKLTKSSSIVLIPRRFSFPTCHRNSNTYTRSVSMSSESGWIKSVSKSAFGFGVSAAFLFSVFCDSHSALAHSLTVAFPISRAPEVNAVQRTLVEAWGLIRETFVDPTFNHQDWDLKLQQTMVEMFPLNSADAAYTKIRGMLSTLGDPFTRIISPQEYQGFRIGSDGNLQGVGLFINVEPRTGHLVSYL* |
ORF Type | complete |
Blastp | Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 70.55% of identity |
---|---|
Blastx | Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 77.23% of identity |
Eggnog | protease(COG0793) |
Kegg | Link to kegg annotations (AT3G57680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459724.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer