Protein coding transcript 174447

• Transcript: Ll_transcript_89067
• CDS coordinates: 142-1065 (+)
• Peptide sequence: MNNLYYLNLKATIPLKLTKSSSIVLIPRRFSFPTCHRNSNTYTRSVSMSSESGWIKSVSKSAFGFGVSAAFLFSVFCDSHSALAHSLTVAFPISRAPEVNAVQRTLVEAWGLIRETFVDPTFNHQDWDLKLQQTMVEMFPLNSADAAYTKIRGMLSTLGDPFTRIISPQEYQGFRIGSDGNLQGVGLFINVEPRTGHLIVFSCIEGSPAARAGIHQGDELVEINGERLDGIDSEAAAQRLRGNAGTTVTVKVKDSGKNFDIREVKLQREFIKLSPISVAIIPHRSPDGKVTKTGYVKLSAFSQVSEE*
• ORF Type: complete

Annotations of Ll_transcript_89067

• Blastp: Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 69.49% of identity
• Blastx: Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 69.49% of identity
• Eggnog: protease(COG0793)
• Kegg: Link to kegg annotations (AT3G57680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459724.1)
• Pfam: PDZ domain (Also known as DHR or GLGF) (PF00595.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;