Protein coding transcript 174451

• Transcript: Ll_transcript_89072
• CDS coordinates: 142-753 (+)
• Peptide sequence: MNNLYYLNLKATIPLKLTKSSSIVLIPRRFSFPTCHRNSNTYTRSVSMSSESGWIKSVSKSAFGFGVSAAFLFSVFCDSHSALAHSLTVAFPISRAPEVNAVQRTLVEAWGLIRETFVDPTFNHQDWDLKLQQTMVEMFPLNSADAAYTKIRGMLSTLGDPFTRIISPQEYQGFRIGSDGNLQGVGLFINVEPRTGHLVSYLW*
• ORF Type: complete

Annotations of Ll_transcript_89072

• Blastp: Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 70.55% of identity
• Blastx: Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 59.31% of identity
• Eggnog: protease(COG0793)
• Kegg: Link to kegg annotations (AT3G57680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459724.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;