Transcript | Ll_transcript_89096 |
---|---|
CDS coordinates | 1255-1824 (+) |
Peptide sequence | MKHAIQELENQDVHSYILDLRNNPGGLVKAGLDVAQIWLDGDETLVNTIDRSGNMLPINMINGHAITHDPLVVIVNEGSASASEILAGALHDNGRAILVGNKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGIIPDVQCTTEMLNSTKKISMKDKSLASSLEADSCIMVAEQELDMKGTAS* |
ORF Type | complete |
Blastp | Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 77.72% of identity |
---|---|
Blastx | Carboxyl-terminal-processing peptidase 3, chloroplastic from Arabidopsis with 60.59% of identity |
Eggnog | protease(COG0793) |
Kegg | Link to kegg annotations (AT3G57680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459724.1) |
Pfam | Peptidase family S41 (PF03572.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer