Transcript | Ll_transcript_318114 |
---|---|
CDS coordinates | 26-982 (+) |
Peptide sequence | MGKSLHKATSSAGDNPPGKRIRRSKAICSCNSPRPPFLSAHSTFSWYEEDMWTEIAKFLDGKSLVMLAATNRWFRRAIMEDTIWKFVCLRDLQVPPSPCVAFKWSKLYTSAFDGSHSYMFRQQEKHIDWMRIGAFSFDSSEAILAERLAFPGKIRTKEAMEKMLKSQGCCMLENVKPGIWIADLQLVRCPVCDLNMCDGTMQTLDARHIELFLCEDYQNGSWEYELVGSHDVKKRADGAAGAIFDPKHLEDSSTAAVFDYKSWIGKSNDWQPKAMIAFHAVAVNTNLQENEGLHVKYHAMRAGTDGQVVSIRISQQLL* |
ORF Type | complete |
Blastp | Probable F-box protein At3g61730 from Arabidopsis with 61.89% of identity |
---|---|
Blastx | Probable F-box protein At3g61730 from Arabidopsis with 61.89% of identity |
Eggnog | F-box protein(ENOG4111KNI) |
Kegg | Link to kegg annotations (AT3G61730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460382.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer