Protein coding transcript 174592

• Transcript: Ll_transcript_91002
• CDS coordinates: 1-483 (+)
• Peptide sequence: YASKKARLSTFKLLLLLNVFGYGAMLLATLYLSKGKKRLAIIGWICLVFNISVFAAPLFIMKKVITTRSVEYMPFTLSFFLTINAVMWFFYGLFLRDYYIALPNTLGFLFGIVQMVLYLMYRNATPVALENPMKVQELNGHIVDVVKGQDVAKGGDIGKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_91002

• Blastp: Bidirectional sugar transporter SWEET10 from Arabidopsis with 52.03% of identity
• Blastx: Bidirectional sugar transporter SWEET10 from Arabidopsis with 45.81% of identity
• Eggnog: sugar transporter(ENOG4111M4R)
• Kegg: Link to kegg annotations (AT5G50790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464754.1)
• Pfam: Sugar efflux transporter for intercellular exchange (PF03083.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;