Protein coding transcript 174599

• Transcript: Ll_transcript_91010
• CDS coordinates: 724-1320 (+)
• Peptide sequence: MVNEKPFMYRVSAAGPNLYKKGKGCGACYKVKCRDKEICAKRAVTVIITDECPGCPPVHFDLSGAAFGRMAVQGKNGHLRNKGRLPIIFKRVSCQYPGKEISFQVNEGSSPHFLSVLVKFVRGDGEIASMYLQQGGSKDWIPMTNLWGANWAITKGPLKGPYSLRIITNTGKSFTSKNVIPNNFSPKTTYTAGKRAPR*
• ORF Type: complete

Annotations of Ll_transcript_91010

• Blastp: Expansin-B3 from Arabidopsis with 53.85% of identity
• Blastx: Expansin-B3 from Arabidopsis with 54.9% of identity
• Eggnog: May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity)(ENOG410YA5Q)
• Kegg: Link to kegg annotations (AT4G28250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429634.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;