Transcript | Ll_transcript_88888 |
---|---|
CDS coordinates | 315-761 (+) |
Peptide sequence | MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRTDCKPPGVGRGRGRGGREDGPGGRPAKGIGRGIDEGGARGQGGSRGGRGGLGGNRGVGRGRG* |
ORF Type | complete |
Blastp | Probable U6 snRNA-associated Sm-like protein LSm4 from Nicotiana with 89.26% of identity |
---|---|
Blastx | Probable U6 snRNA-associated Sm-like protein LSm4 from Nicotiana with 89.26% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452640.1) |
Pfam | LSM domain (PF01423.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer