Protein coding transcript 174690

• Transcript: Ll_transcript_88891
• CDS coordinates: 2-562 (+)
• Peptide sequence: TAFLSLSYSVCQKLRHFSNQPCFGFIVLEREVYFFFFKNLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRTDCKPPGVGRGRGRGGREDGPGGRPAKGIGRGIDEGGARGQGGSRGGRGGLGGNRGVGRGRG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_88891

• Blastp: Probable U6 snRNA-associated Sm-like protein LSm4 from Nicotiana with 89.17% of identity
• Blastx: Probable U6 snRNA-associated Sm-like protein LSm4 from Nicotiana with 89.17% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441770.1)
• Pfam: LSM domain (PF01423.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;