Protein coding transcript 174702

• Transcript: Ll_transcript_89103
• CDS coordinates: 1081-1494 (+)
• Peptide sequence: MYIYNVDTIMIYCAGHLTPRSDVYSFGVVLLELLTGRKSLDRLRPAREQNLTEWALPLLKEKKKLLNIIDPRLEGDYPIKGVHKAAMLVYHCLNRNPKARPLMRDIVDSLEPLQQANNEVSIGKTFTIINEVPEADV*
• ORF Type: complete

Annotations of Ll_transcript_89103

• Blastp: Probable serine/threonine-protein kinase PBL16 from Arabidopsis with 71.2% of identity
• Blastx: Probable serine/threonine-protein kinase PBL16 from Arabidopsis with 65.03% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G56460)
• CantataDB: Link to cantataDB annotations (CNT0001383)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464034.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;