Protein coding transcript 174714

• Transcript: Ll_transcript_90416
• CDS coordinates: 3-560 (+)
• Peptide sequence: EHGKCIKGFVLSIHVELLCPDHLFFVVVIEPNWHVMYNRLHSANSIDEVIQYHDLFLDKCLRECLLLLPELLKKVERLKSMCLQYAATTQWLISSSIEIHSPEEPINDSISSNKARQRKSGNLSQVLKSTTGSAAVMDSVLKFEKEFNAELQSLGSILSSSSQAEPYLAHLAQSILGVKNEKNGL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_90416

• Blastp: Gamma-tubulin complex component 2 from Arabidopsis with 55.62% of identity
• Blastx: Gamma-tubulin complex component 2 from Arabidopsis with 51.72% of identity
• Eggnog: Tubulin, gamma complex associated protein 2(ENOG410XNRE)
• Kegg: Link to kegg annotations (AT5G17410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432602.1)
• Pfam: Spc97 / Spc98 family (PF04130.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;