Protein coding transcript 174717

• Transcript: Ll_transcript_90419
• CDS coordinates: 180-1244 (+)
• Peptide sequence: MKLNSMEFDNPIGCYDAAVQELIVIDDILSAMVGIEGRHVLIKIVRGKHEDVTFQVDPSMDLALQELAKRIFPLCRSFLLINQFVESRSQFKSGLVNHAFSAALRAFLIDYQAMVAQLEHQFRLGRLSLQGLWFYCQPMMGSMLALSIVIQKASENNFSGSAVLNLLQNQAKAMAGDNAVRLLLEKMTQCASNAYLSILERWVYEGVIDDPYGEFFITENKSLQKETLTQDYDAKYWRQRYSLKDGIPSFLANIAGTILTTGKYLNVMRECGHNVQVPPSENSKLMSYGSNHHYLECIKAAYKFASGELLNLIKEKYDLLGKLQSIKHYLLLDQVSPGGTFPFFWINMLFVWIK*
• ORF Type: complete

Annotations of Ll_transcript_90419

• Blastp: Gamma-tubulin complex component 2 from Arabidopsis with 79.75% of identity
• Blastx: Gamma-tubulin complex component 2 from Arabidopsis with 79.75% of identity
• Eggnog: Tubulin, gamma complex associated protein 2(ENOG410XNRE)
• Kegg: Link to kegg annotations (AT5G17410)
• CantataDB: Link to cantataDB annotations (CNT0001755)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432602.1)
• Pfam: Spc97 / Spc98 family (PF04130.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;