Transcript | Ll_transcript_90421 |
---|---|
CDS coordinates | 180-806 (+) |
Peptide sequence | MKLNSMEFDNPIGCYDAAVQELIVIDDILSAMVGIEGRHVLIKIVRGKHEDVTFQVDPSMDLALQELAKRIFPLCRSFLLINQFVESRSQFKSGLVNHAFSAALRAFLIDYQAMVAQLEHQFRLGRLSLQGLWFYCQPMMGSMLALSIVIQKASENNFSGSAVLNLLQNQAKAMAGDNAVRLLLEKMTQCASNAYLSILERCLPFSLL* |
ORF Type | complete |
Blastp | Gamma-tubulin complex component 2 from Arabidopsis with 78.76% of identity |
---|---|
Blastx | Gamma-tubulin complex component 2 from Arabidopsis with 71.56% of identity |
Eggnog | Tubulin, gamma complex associated protein 2(ENOG410XNRE) |
Kegg | Link to kegg annotations (AT5G17410) |
CantataDB | Link to cantataDB annotations (CNT0001755) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432602.1) |
Pfam | Spc97 / Spc98 family (PF04130.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer