Protein coding transcript 174749

• Transcript: Ll_transcript_89385
• CDS coordinates: 198-584 (+)
• Peptide sequence: MRQLLSGIEHCHVRGIMHRDIKVSNILVNNEGVLKIGDFGLANTISPNNKHPLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFAELYLGKPILKGRTEVEQLHKIFKLCGTPPDEYWKKFKLPHA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_89385

• Blastp: Protein IMPAIRED IN BABA-INDUCED STERILITY 1 from Arabidopsis with 77.69% of identity
• Blastx: Protein IMPAIRED IN BABA-INDUCED STERILITY 1 from Arabidopsis with 78.52% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPIR)
• Kegg: Link to kegg annotations (AT1G18670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442692.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;