Transcript | Ll_transcript_89385 |
---|---|
CDS coordinates | 198-584 (+) |
Peptide sequence | MRQLLSGIEHCHVRGIMHRDIKVSNILVNNEGVLKIGDFGLANTISPNNKHPLTSRVVTLWYRPPELLMGSTSYGVSVDLWSVGCVFAELYLGKPILKGRTEVEQLHKIFKLCGTPPDEYWKKFKLPHA |
ORF Type | 3prime_partial |
Blastp | Protein IMPAIRED IN BABA-INDUCED STERILITY 1 from Arabidopsis with 77.69% of identity |
---|---|
Blastx | Protein IMPAIRED IN BABA-INDUCED STERILITY 1 from Arabidopsis with 78.52% of identity |
Eggnog | Cyclin-Dependent Kinase(ENOG410XPIR) |
Kegg | Link to kegg annotations (AT1G18670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442692.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer