Protein coding transcript 174793

• Transcript: Ll_transcript_91393
• CDS coordinates: 498-995 (+)
• Peptide sequence: MSVNLSKNTSKGHEQMVISQEQKAKINEVRKLIGSLSDKASVYCSDESISRYLSSRNWNVQKGAQMLKLSLKWREEYKPEEICWEDIADEAATGKMYRSNYNDKHGRTVLVIRPRHQLNTKTIQGQIKYFVYCMENAALNLPPHQEGMVWLIDFQGLCLSNISLKL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_91393

• Blastp: Random slug protein 5 from Dictyostelium with 26.62% of identity
• Blastx: Random slug protein 5 from Dictyostelium with 26.62% of identity
• Eggnog: CRAL TRIO domain protein(ENOG410Y3Q0)
• Kegg: Link to kegg annotations (DDB_G0269182)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415075.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;