Protein coding transcript 174798

• Transcript: Ll_transcript_91373
• CDS coordinates: 829-1131 (+)
• Peptide sequence: MLKLSLKWREEYKPEEICWEDIADEAATGKMYRSNYNDKHGRTVLVIRPRHQLNTKTIQGQIKYFVYCMENAALNLPPHQEGMVWLIDFQGLCLSNISLKL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_91373

• Blastp: CRAL-TRIO domain-containing protein C23B6.04c from Schizosaccharomyces with 37.21% of identity
• Blastx: Random slug protein 5 from Dictyostelium with 27.78% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC23B6.04c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415075.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;