Transcript | Ll_transcript_89923 |
---|---|
CDS coordinates | 149-550 (+) |
Peptide sequence | MSEAPASPGGGGGGGGSHENGDHSPRSNHREQDRFLPIANISRIMKKVLPPNGKIAKDAKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDLLKIYLARYREVISISTFYFTFLL* |
ORF Type | complete |
Blastp | Nuclear transcription factor Y subunit B-8 from Arabidopsis with 83.78% of identity |
---|---|
Blastx | Nuclear transcription factor Y subunit B-1 from Arabidopsis with 75.21% of identity |
Eggnog | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling(COG2036) |
Kegg | Link to kegg annotations (AT2G37060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443047.1) |
Pfam | Histone-like transcription factor (CBF/NF-Y) and archaeal histone (PF00808.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer