Protein coding transcript 174908

• Transcript: Ll_transcript_89936
• CDS coordinates: 142-543 (+)
• Peptide sequence: MSEAPASPGGGGGGGGSHENGDHSPRSNHREQDRFLPIANISRIMKKVLPPNGKIAKDAKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDLLKIYLARYREVISISTFYFTFLL*
• ORF Type: complete

Annotations of Ll_transcript_89936

• Blastp: Nuclear transcription factor Y subunit B-8 from Arabidopsis with 83.78% of identity
• Blastx: Nuclear transcription factor Y subunit B-1 from Arabidopsis with 72.73% of identity
• Eggnog: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling(COG2036)
• Kegg: Link to kegg annotations (AT2G37060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443047.1)
• Pfam: Histone-like transcription factor (CBF/NF-Y) and archaeal histone (PF00808.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;