Protein coding transcript 1750

• Transcript: Ll_transcript_318181
• CDS coordinates: 139-522 (+)
• Peptide sequence: MEGLGKWRCWEFLLLVLLLVLPGLCFFIFVYCSRRTRDEDDNAFGGKLQKGGMSPEKVVSWNQDENNKLTFFEWCNYAFDLEDLLTASVEVLRKGTFGTVYKVVLEDATMVVVKRLKEVAVGRKEFE*
• ORF Type: complete

Annotations of Ll_transcript_318181

• Blastp: Probable inactive receptor kinase At4g23740 from Arabidopsis with 62.62% of identity
• Blastx: Probable inactive receptor kinase At4g23740 from Arabidopsis with 64.63% of identity
• Eggnog: Leucine rich repeat N-terminal domain(ENOG410YDXU)
• Kegg: Link to kegg annotations (AT4G23740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446546.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;