Protein coding transcript 175028

• Transcript: Ll_transcript_140696
• CDS coordinates: 130-897 (+)
• Peptide sequence: MRRNSPGYYSPPRRGYGGRGRSPPPPSPPYRRGHGGGGGRRRESNNGSLLVRNIPLDCRPEELRIPFERFGPVRDVYIPKDYYSGQPRGFAFVQFVDPYDASEAQYHMNGQIFAGREVTVVVAAETRKRPEEMRHRTSRFRGQGSYGGRRSSPYGRYRSRSISRSRSRSPPYHSGSRNRYHSRSYSPAPRRQNDYSVSPRRPVEHPRSPRSPLGERDGDQKRRSYSPGERDGEHNRRSYSPAYGADQNPSNGYAE*
• ORF Type: complete

Annotations of Ll_transcript_140696

• Blastp: Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 80.29% of identity
• Blastx: Serine/arginine-rich SC35-like splicing factor SCL30 from Arabidopsis with 83.15% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G55460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460822.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;