Protein coding transcript 175070

• Transcript: Ll_transcript_142144
• CDS coordinates: 408-1205 (+)
• Peptide sequence: MHTSINFVCRNPDHPFSSGVSLAKLAAVTLDEQGNETFDTSGALDRLRKSVHLERLALYHDSDRHPWEIHKRWEDISPSEWIEIFGDGINEPTDDHKLVSKWAMNRTYLVYPINAVLQYHRLGNQERINPEIPFEKVSLVLTDVSLTLTEAQYHDWIKLLEVVSRYKIYMEVSHLRPAVPISKAPYLWWQYAAHAMQQQKMCYRLSWDQIRHLCQQRRRYIQLYVASLQHSAHVNLAEIREIERDLDSKVILLWRWRMSYCIFVLT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_142144

• Blastp: Vacuolar protein sorting-associated protein 13 from Saccharomyces with 24.61% of identity
• Blastx: Vacuolar protein sorting-associated protein 13 from Saccharomyces with 24.61% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YLL040C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418850.1)
• Pfam: Vacuolar sorting-associated protein 13, N-terminal (PF16908.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;