Protein coding transcript 175073

• Transcript: Ll_transcript_142147
• CDS coordinates: 408-1319 (+)
• Peptide sequence: MHTSINFVCRNPDHPFSSGVSLAKLAAVTLDEQGNETFDTSGALDRLRKSVHLERLALYHDSDRHPWEIHKRWEDISPSEWIEIFGDGINEPTDDHKLVSKWAMNRTYLVYPINAVLQYHRLGNQERINPEIPFEKVSLVLTDVSLTLTEAQYHDWIKLLEVVSRYKIYMEVSHLRPAVPISKAPYLWWQYAAHAMQQQKMCYRLSWDQIRHLCQQRRRYIQLYVASLQHSAHVNLAEIREIERDLDSKVILLWRLLAHAKVESVKSKVAAEERRIKKKSWFSFSWGADTEEVSLNDASEGSQL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_142147

• Blastp: Putative vacuolar protein sorting-associated protein 13A from Dictyostelium with 24.26% of identity
• Blastx: Putative vacuolar protein sorting-associated protein 13A from Dictyostelium with 24.26% of identity
• Eggnog: Vacuolar Protein(COG5043)
• Kegg: Link to kegg annotations (DDB_G0286725)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418850.1)
• Pfam: Vacuolar sorting-associated protein 13, N-terminal (PF16908.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;