Protein coding transcript 1751

• Transcript: Ll_transcript_318102
• CDS coordinates: 3-521 (+)
• Peptide sequence: PEVWPSHPEVQRVVNKFRTMPEHEQNKYMLNQESFLTKSIMKTRDQLKKLRNENKKIEMELFMFQCLSTGSTNNMVDSNDLLCVINQSLKEIEWKKSRVQPQQGTVEAAKPSNEGNTIVDAHNHIQGMMQSNMGPMQMQDWSFDSATGGGNLMLPFRDYNISNGFWHGPSFH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_318102

• Blastp: Agamous-like MADS-box protein AGL80 from Arabidopsis with 40.8% of identity
• Blastx: Agamous-like MADS-box protein AGL80 from Arabidopsis with 46.88% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT5G48670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439095.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;