Protein coding transcript 175157

• Transcript: Ll_transcript_142546
• CDS coordinates: 3-506 (+)
• Peptide sequence: RLSKEQALGLEETFKEHNTLNPKQKQALANQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENKRLQKEVQELRALKLSPQLYMHMNPPTTLTMCPSCERVAVSSTSSSSSSATMPSALSLANRNPPRPNIQRPVPINPWAAMQIQHRPFDGPTSRP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_142546

• Blastp: Homeobox-leucine zipper protein HAT3 from Arabidopsis with 72.84% of identity
• Blastx: Homeobox-leucine zipper protein HAT3 from Arabidopsis with 90.91% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT3G60390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464444.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;