Protein coding transcript 175222

• Transcript: Ll_transcript_141619
• CDS coordinates: 113-493 (+)
• Peptide sequence: MSSIIEKGYGVGDIISLLWFKRSLPRYCTQFIEICVMLCADHGPCVSGAHNTIVTARAGKDLVSSLVSGLLTIGPRFGGAIDDAACYFKDARDRALTPYEFVESMKKKGIRVPGIGHRIKNRDNKDK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_141619

• Blastp: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 92.13% of identity
• Blastx: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 91.46% of identity
• Eggnog: Succinyl-CoA ligase ADP-forming subunit alpha(COG0074)
• Kegg: Link to kegg annotations (AT3G06650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425314.1)
• Pfam: Citrate synthase, C-terminal domain (PF00285.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;