Protein coding transcript 17525

• Transcript: Ll_transcript_357073
• CDS coordinates: 202-951 (+)
• Peptide sequence: MENADVFLGLHDFLDRMRQPSASDFVKSIKSFIVSFSNNVPDPERDSTSVQEFFSNMEAAFRAHPLWAGCSEDELESAGEGLEKYVMTKLFSRVFASVPDDVKLDEQLSEKMALFQQFIRPENLDITPAFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVIGNLLLNASVTSNENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRFRHQSRLVGEAAYYFTNMLSAESFISNIDAKAISMDET
• ORF Type: 3prime_partial

Annotations of Ll_transcript_357073

• Blastp: Vacuolar protein sorting-associated protein 9A from Arabidopsis with 82.73% of identity
• Blastx: Vacuolar protein sorting-associated protein 9A from Arabidopsis with 82.73% of identity
• Eggnog: guanine nucleotide exchange factor(ENOG410YGAZ)
• Kegg: Link to kegg annotations (AT3G19770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415562.1)
• Pfam: Vacuolar sorting protein 9 (VPS9) domain (PF02204.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;