Transcript | Ll_transcript_357073 |
---|---|
CDS coordinates | 202-951 (+) |
Peptide sequence | MENADVFLGLHDFLDRMRQPSASDFVKSIKSFIVSFSNNVPDPERDSTSVQEFFSNMEAAFRAHPLWAGCSEDELESAGEGLEKYVMTKLFSRVFASVPDDVKLDEQLSEKMALFQQFIRPENLDITPAFQNETSWLLAQKELQKINMYKAPRDKLVCILNCCKVIGNLLLNASVTSNENPPGADEFLPVLIYVTLKANPPQLHSNLLYIQRFRHQSRLVGEAAYYFTNMLSAESFISNIDAKAISMDET |
ORF Type | 3prime_partial |
Blastp | Vacuolar protein sorting-associated protein 9A from Arabidopsis with 82.73% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 9A from Arabidopsis with 82.73% of identity |
Eggnog | guanine nucleotide exchange factor(ENOG410YGAZ) |
Kegg | Link to kegg annotations (AT3G19770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415562.1) |
Pfam | Vacuolar sorting protein 9 (VPS9) domain (PF02204.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer