Protein coding transcript 175488

• Transcript: Ll_transcript_142627
• CDS coordinates: 184-840 (+)
• Peptide sequence: MAILYALVARGSVVLAEFSAVTGNTGAVARRLLDNLPAEADSRLCFSQDRYIFHILRSDGLTYLCMANDSFGRGIPFSYLEDVQMRFMKNYGKVANYAPAYAMNDEFSRVLHHQMEFFSSNSSADTLNRVRGEVGEIRTIMVDNIEKILERGDRIELLVDKTSTMQDSAFHFRKQSKRLQRALWMKNFKLLVLMTLLIVLFLYLIIAACCGGITLPSC*
• ORF Type: complete

Annotations of Ll_transcript_142627

• Blastp: Vesicle-associated membrane protein 714 from Arabidopsis with 81.74% of identity
• Blastx: Vesicle-associated membrane protein 714 from Arabidopsis with 81.31% of identity
• Eggnog: Vesicle-associated membrane protein(COG5143)
• Kegg: Link to kegg annotations (AT5G22360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453853.1)
• Pfam: Regulated-SNARE-like domain (PF13774.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;