Transcript | Ll_transcript_142630 |
---|---|
CDS coordinates | 184-846 (+) |
Peptide sequence | MAILYALVARGSVVLAEFSAVTGNTGAVARRLLDNLPAEADSRLCFSQDRYIFHILRSDGLTYLCMANDSFGRGIPFSYLEDVQMRFMKNYGKVANYAPAYAMNDEFSRVLHHQMEFFSSNSSADTLNRVRGEVGEIRTIMVDNIEKILERGDRIELLVDKTSTMQDNAFHFRKQSKRLRRALWMKNFKLLVLLTVLIVLFLYLIIAACCGGITLPSCRS* |
ORF Type | complete |
Blastp | Vesicle-associated membrane protein 714 from Arabidopsis with 82.35% of identity |
---|---|
Blastx | Vesicle-associated membrane protein 714 from Arabidopsis with 82.35% of identity |
Eggnog | Vesicle-associated membrane protein(COG5143) |
Kegg | Link to kegg annotations (AT5G22360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453853.1) |
Pfam | Regulated-SNARE-like domain (PF13774.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer