Protein coding transcript 17552

• Transcript: Ll_transcript_355698
• CDS coordinates: 242-991 (+)
• Peptide sequence: MSIIRELIFLKNTFKCKTPKVILICSFKTHSSLSMIDLILPISSTPYDISNLKLQIEAYITKDKEPQLNNQTYLQTKWFKPNPTDAPIYAILGSNSWLWLGTIISSSFIIFLIIIGILIRYYIFPIENDPNDTFSNPLKSFLHMLIICGSIVMVASIAFLLNKKHNAKEDKKIQDMEGLTPIVIPNSMSYNTNRELESLPCESLIQVTNVHYGVRPDLRRLLFEIKGSSVKVLASGPKKMRQEVAAICSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_355698

• Blastp: Ferric reduction oxidase 5 from Arabidopsis with 45.91% of identity
• Blastx: Ferric reduction oxidase 5 from Arabidopsis with 50.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G23990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432222.1)
• Pfam: Ferric reductase NAD binding domain (PF08030.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;