| Transcript | Ll_transcript_142369 |
|---|---|
| CDS coordinates | 3-323 (+) |
| Peptide sequence | NLSPHIKRTIFPIATTSERRKSSSKRPNLSSLRNPTHSTMSRRKVREPKEETVTLGPAVRDGEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGNCLSFVVIEF* |
| ORF Type | 5prime_partial |
| Blastp | 40S ribosomal protein S14 from Lupinus with 93.1% of identity |
|---|---|
| Blastx | 40S ribosomal protein S14 from Lupinus with 93.1% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433773.1) |
| Pfam | Ribosomal protein S11 (PF00411.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer