Protein coding transcript 175592

• Transcript: Ll_transcript_142373
• CDS coordinates: 3-365 (+)
• Peptide sequence: RNSHPAKRFIYPSSFSHLFLTHKFYSFIFLDFRLIRMSRRKVREPKEETVTLGPAVRDGEHVFFFFCIFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLAAQDVATRCK
• ORF Type: internal

Annotations of Ll_transcript_142373

• Blastp: 40S ribosomal protein S14 from Lupinus with 91.76% of identity
• Blastx: 40S ribosomal protein S14 from Lupinus with 91.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433773.1)
• Pfam: Ribosomal protein S11 (PF00411.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;