Transcript | Ll_transcript_142350 |
---|---|
CDS coordinates | 3-323 (+) |
Peptide sequence | NLSPHIKRTIFPIATTSERRKSSSKRPNLSSLRNPTHSTMSRRKVREPKEETVTLGPAVRDGEHVFGVARIFASFNDTFIHVTDLSGRETLVRITGNCLSFVVIEF* |
ORF Type | 5prime_partial |
Blastp | 40S ribosomal protein S14 from Lupinus with 93.1% of identity |
---|---|
Blastx | 40S ribosomal protein S14 from Lupinus with 93.1% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433773.1) |
Pfam | Ribosomal protein S11 (PF00411.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer