Transcript | Ll_transcript_417296 |
---|---|
CDS coordinates | 175-558 (+) |
Peptide sequence | MQNLGNFKLPHFFNYPPYFTLQPVRDTREKQIQLWKDLILDYCRTQKIFVIALEEEFPLFSNPVIESKFEIRAFLPIFVKIIELTSPGSSIIFLSCLFQPLCRMIVFKFLIVQGLLLMNPEMRFFQP* |
ORF Type | complete |
Blastp | Vacuolar protein sorting-associated protein 25 from Arabidopsis with 72.6% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 25 from Arabidopsis with 69.88% of identity |
Eggnog | vacuolar protein sorting 25 homolog (S. cerevisiae)(ENOG4111F6Y) |
Kegg | Link to kegg annotations (AT4G19003) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020237502.1) |
Pfam | ESCRT-II complex subunit (PF05871.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer