Protein coding transcript 1756

• Transcript: Ll_transcript_417296
• CDS coordinates: 175-558 (+)
• Peptide sequence: MQNLGNFKLPHFFNYPPYFTLQPVRDTREKQIQLWKDLILDYCRTQKIFVIALEEEFPLFSNPVIESKFEIRAFLPIFVKIIELTSPGSSIIFLSCLFQPLCRMIVFKFLIVQGLLLMNPEMRFFQP*
• ORF Type: complete

Annotations of Ll_transcript_417296

• Blastp: Vacuolar protein sorting-associated protein 25 from Arabidopsis with 72.6% of identity
• Blastx: Vacuolar protein sorting-associated protein 25 from Arabidopsis with 69.88% of identity
• Eggnog: vacuolar protein sorting 25 homolog (S. cerevisiae)(ENOG4111F6Y)
• Kegg: Link to kegg annotations (AT4G19003)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020237502.1)
• Pfam: ESCRT-II complex subunit (PF05871.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;