Transcript | Ll_transcript_141831 |
---|---|
CDS coordinates | 339-785 (+) |
Peptide sequence | MEPRVGNKFRLGRKLGSGSFGEIYLATNIQTNEEVAVKLEKAKTKHPQLLYESKLYKILQGGTGIPNVRWFGVEGEYNVLVMDLLGSSLEDLFNFCSRKLSLKTVLMLADQMINRVEYVHSKSYLHRDIKPDNFLMGLGRRANQVYAID |
ORF Type | 3prime_partial |
Blastp | Casein kinase 1-like protein 2 from Arabidopsis with 87.92% of identity |
---|---|
Blastx | Casein kinase 1-like protein 2 from Arabidopsis with 87.92% of identity |
Eggnog | Casein Kinase(ENOG410XPGP) |
Kegg | Link to kegg annotations (AT1G72710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448236.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer