Protein coding transcript 175648

• Transcript: Ll_transcript_141021
• CDS coordinates: 2515-3483 (+)
• Peptide sequence: MLNFASNSVSCLFSDFIVFVFPGYRIRAGSASPVHRRDANHRFGSDYNHLSQSRGYGGGRDPGRYRDPSPPYFRGKVGGRPVGRAFDRPGFVPGLARGEGNSRNNPNVRPREGDWICPDIRCGNLNFARRDYCNKCNRSRPAPAESPRRAYPGPPPLRSSPRRFPGSPERTVIGYRSPPRGLARDGPREYGSAALPPLRHEGRFTDPHLHKDRIDYLEDAYRGRNKFDRPPPPLEWESRDRGRNGFSNERKAFERRPLSPHAPLLPSLPPHHGGRWAQDVRERSRSPIRGSPPPKDYRRDMFVNRGRGDRRALGRDRTGGMY*
• ORF Type: complete

Annotations of Ll_transcript_141021

• Blastp: Zinc finger Ran-binding domain-containing protein 2 from Sus with 56.41% of identity
• Blastx: TATA-binding protein-associated factor 2N from Homo with 64.29% of identity
• Eggnog: Zinc finger, RAN-binding domain containing 2(ENOG4111QXA)
• Kegg: Link to kegg annotations (733651)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448374.1)
• Pfam: Zn-finger in Ran binding protein and others (PF00641.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;